PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01037136001
Common NameVIT_18s0089g00910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ARF
Protein Properties Length: 644aa    MW: 71679 Da    PI: 6.6765
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01037136001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.1e-23125225198
                        EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                        f+k+lt sd++++g +++ +++a+e+       ++++   ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   
  GSVIVT01037136001 125 FCKTLTASDTSTHGGFSVLRRHADEClppldmsQNPPW--QELVAKDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLAAGDAFIFL-- 212
                        99****************************97444444..48************************************************.. PP

                        SSSEE..EEEEE- CS
                 B3  86 grsefelvvkvfr 98 
                        + +++el+v+v+r
  GSVIVT01037136001 213 RGENGELRVGVRR 225
                        449999*****97 PP

2Auxin_resp112.44.4e-37251333183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha++t++ F+v+Y+Pras+seF+v+v+k+++a ++kvsvGmRfkm+fe+++++err+sGt+vgv d+ ++ W++S+WrsLk
  GSVIVT01037136001 251 ASHAITTGTLFSVFYKPRASPSEFIVSVNKYLEARNHKVSVGMRFKMRFEGDEAPERRFSGTIVGVGDTGSSGWTDSEWRSLK 333
                        789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-42114254IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.0E-40122240IPR015300DNA-binding pseudobarrel domain
CDDcd100171.32E-20123225No hitNo description
PROSITE profilePS5086311.505125227IPR003340B3 DNA binding domain
SMARTSM010191.2E-21125227IPR003340B3 DNA binding domain
PfamPF023624.7E-21125225IPR003340B3 DNA binding domain
PfamPF065074.7E-35251333IPR010525Auxin response factor
PfamPF023091.8E-7488555IPR033389AUX/IAA domain
PROSITE profilePS5174528.248519612IPR000270PB1 domain
SuperFamilySSF542779.81E-12522596No hitNo description
PfamPF023091.2E-5566609IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MAALNYQLNG SKLGTVNDAL YKELWHACAG PLVNVPREQE RVYYFPQGHM EQLEASMHQG  60
LDQKMPSFNL PSKILCKVVN VHLRAEPETD EVYAQVTLLP EPDQSEITSP DPPLPEPQSC  120
TVHSFCKTLT ASDTSTHGGF SVLRRHADEC LPPLDMSQNP PWQELVAKDL HGNEWHFRHI  180
FRGQPRRHLL TTGWSVFVSS KRLAAGDAFI FLRGENGELR VGVRRLMRQL NNVPPSVISS  240
HSMHLGVLAT ASHAITTGTL FSVFYKPRAS PSEFIVSVNK YLEARNHKVS VGMRFKMRFE  300
GDEAPERRFS GTIVGVGDTG SSGWTDSEWR SLKVQWDEPS SILRPERVSP WELEPLVTET  360
PLTAQPMQRS KRPRSPVLSS PTPGLSAFAV KTNSHSFTVN YSSTAVSNNS AYWPQQSEPV  420
PELFTPVPNK EYGKKKPENG NGYRLFGIQL VDNSNVEETL PVTTISSGAG EDQPVVCLDA  480
DSDHQSQRSN INQSKTPTVG SDPEKSCLGS SLLQSRQIRS CTKVHMQGMA VGRAVDLTQF  540
SSYKELLSKL EEMFDIKGEL CGPTKKWQVV YTDDEDDMMM VGDDPWHEFC SMVRKIFIYT  600
VEEVKELSPK AKLPLKGEFK PGKPDSKTTI GTEDHSSMVG SGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.013561355Auxin response factor 1
4ldw_A0.013561355Auxin response factor 1
4ldw_B0.013561355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.98550.0bud| flower| leaf| root
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3831180.0FQ383118.1 Vitis vinifera clone SS0ABG31YC05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266947.10.0PREDICTED: auxin response factor 1-like
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLF6GVY50.0F6GVY5_VITVI; Auxin response factor
STRINGVIT_18s0089g00910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1